PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_83918g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 405aa    MW: 45451.8 Da    PI: 7.1321
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_83918g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.9e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++lv+++++ G g+W++ ++  g++R++k+c++rw +yl
    MA_83918g0010 14 KGPWTCEEDQILVNYIQKNGHGSWRALPKLAGLRRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding52.71e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +T+eE+  ++++++ lG++ W+ Ia+ ++ gRt++++k++w+++l
    MA_83918g0010  67 RGLFTEEEERTILQLHAILGNR-WSGIAAQLP-GRTDNEIKNHWNTHL 112
                      788*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-23564IPR009057Homeodomain-like
PROSITE profilePS5129416.196961IPR017930Myb domain
SuperFamilySSF466893.21E-3011108IPR009057Homeodomain-like
SMARTSM007175.7E-121363IPR001005SANT/Myb domain
PfamPF002491.0E-141461IPR001005SANT/Myb domain
CDDcd001671.11E-81661No hitNo description
PROSITE profilePS5129427.91162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-2665116IPR009057Homeodomain-like
SMARTSM007171.4E-1666114IPR001005SANT/Myb domain
PfamPF002492.1E-1567112IPR001005SANT/Myb domain
CDDcd001676.76E-1270112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MGRLPCCEKT GLKKGPWTCE EDQILVNYIQ KNGHGSWRAL PKLAGLRRCG KSCRLRWTNY  60
LRPDIKRGLF TEEEERTILQ LHAILGNRWS GIAAQLPGRT DNEIKNHWNT HLKKRLLKMG  120
LDPSTHAPQA EVNSTAPHGS EALALTRHKX XXXXXXENAR LDAEARLARE SLLIPSAGYH  180
NTNTVETIRI TNDTAPTDYF LRIWNSDAGR VFRKESSSGI INQRCNNSYN VFNQSRPSGG  240
LGDGHVLFSG FPETLRISSS VSSLCSASTQ LGCDQSLNPN DKDRDNGSQQ CNSASAEWSG  300
DSMIAKTPQV LSCFADLTMG QREHKAPEDF SRSEELRPAQ VSEEVLLSFP YNDNNNNNNT  360
GCMITELSTS FQQQQSAWPW SELHLEDDRD DWSNIWVIAH ASKHS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-30121162105MYB PROTO-ONCOGENE PROTEIN
1h8a_C6e-301211625128MYB TRANSFORMING PROTEIN
1mse_C6e-30121162105C-Myb DNA-Binding Domain
1msf_C6e-30121162105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010523735.19e-89PREDICTED: transcription repressor MYB6
TrEMBLG7L3J22e-88G7L3J2_MEDTR; Myb transcription factor MIXTA-like protein
STRINGAT3G61250.13e-85(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.14e-77myb domain protein 17